SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CBM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CBM5
Domain Number 1 Region: 341-675
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 8.37e-45
Family Patatin 0.0000458
Further Details:      
 
Domain Number 2 Region: 9-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-26
Family Laminin G-like module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CBM5
Sequence length 686
Comment (tr|A0A1W5CBM5|A0A1W5CBM5_9NOST) Patatin {ECO:0000313|EMBL:OBQ02536.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_26390 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MINLANTQTVLKFDGIDDYIDFGKNDIGGVFAQGSSCFTVSGWINPHKLTEKSTSYGTRN
VFFARSSDRYSDNFEFGISETGSLDIFIDETISKGIRTFGNGELTIGQWHFFAIVFNSGQ
ITVYLDDHEYNDSLRGSSLNKATSSVTLGATLHKQVYFTGQLANISVWNYPCTQVQIKTH
HCGLIVGDEPGLVAYWKLDEGQGTTVKNKAGKSYQGNFRGNPSWDLAQIPFAAPLSSQDD
IQEDVQFEIGIIAETSISTLTTDLLAATVPLVSNNEDQTIEIQYPEINSEKSEIIANLIN
LPSHEEASKTDQTEVLVNSQQLQTFIQAESPETMNTKSRPRYKILSIDGGGIRGIIPALL
LAEIERRTQEPIFSLFDLIAGTSSGGILALGLTKPRLNSSEELPLAEYTAEDLVQLFLEY
GVEIFYEPLFERLLGPLEDIFLQPKYPSTSKEEILRQYLGKTPLVNNLKEVFVTSYDIEQ
RIPVFFTNQLEKQQIESKNSHNLCGNVSLLDAALATSATPTYFAPHRIVSPENSAIAYTL
IDGGVFANNPAHLAILEAQISSKRKAQTVLNQEDILVVSLGTGSPTSAYPYKEVKNWGLL
QWGRPLLNIVFDGGSGVVSGELEQLFEPSDKEAKSFYYRFQTLLDAELEAIDNTKLQNTR
QLQAIAHKLISEKSQQIDELCELLLG
Download sequence
Identical sequences A0A1W5CBM5 Q3MCP3
gi|75907842|ref|YP_322138.1| 240292.Ava_1620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]