SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CBS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CBS0
Domain Number 1 Region: 507-1072
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.13e-187
Family Acetyl-CoA synthetase-like 0.0000000019
Further Details:      
 
Domain Number 2 Region: 2660-3212
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 9.16e-179
Family Acetyl-CoA synthetase-like 0.000000000986
Further Details:      
 
Domain Number 3 Region: 1581-2151
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 9.03e-163
Family Acetyl-CoA synthetase-like 0.00000000579
Further Details:      
 
Domain Number 4 Region: 2426-2690
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.56e-72
Family NRPS condensation domain (amide synthase) 0.023
Further Details:      
 
Domain Number 5 Region: 272-537
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 6.78e-72
Family NRPS condensation domain (amide synthase) 0.023
Further Details:      
 
Domain Number 6 Region: 1346-1611
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.45e-71
Family NRPS condensation domain (amide synthase) 0.021
Further Details:      
 
Domain Number 7 Region: 87-264
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 7.41e-51
Family NRPS condensation domain (amide synthase) 0.012
Further Details:      
 
Domain Number 8 Region: 1150-1339
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 6.67e-47
Family NRPS condensation domain (amide synthase) 0.018
Further Details:      
 
Domain Number 9 Region: 2229-2418
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.45e-46
Family NRPS condensation domain (amide synthase) 0.024
Further Details:      
 
Domain Number 10 Region: 1051-1160
Classification Level Classification E-value
Superfamily ACP-like 2.09e-22
Family Peptidyl carrier domain 0.0018
Further Details:      
 
Domain Number 11 Region: 2130-2239
Classification Level Classification E-value
Superfamily ACP-like 2.62e-22
Family Peptidyl carrier domain 0.0012
Further Details:      
 
Domain Number 12 Region: 3191-3265
Classification Level Classification E-value
Superfamily ACP-like 7.07e-20
Family Peptidyl carrier domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CBS0
Sequence length 3308
Comment (tr|A0A1W5CBS0|A0A1W5CBS0_9NOST) Non-ribosomal peptide synthetase {ECO:0000313|EMBL:OBQ02542.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_26435 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MTNSTVEFVRHLTSLKIEIEIDGVSGAPPAEIRLRCHAPEGVLTPTLRQEIAARKTEIIL
FLQQAKQVKAAHQSSIQPVSRDGDLPLSSAQQRLWFLHQLSPDSRSYNMLLIQRLNGSVN
IVALEQSLREIVRRHEILRTTFPAVDGKPVQVIAVSTALALPVHDLQGLSAEEQTDRIRQ
IANYQASQPFDLVVGPLVQITLLQLSNQKYILLLKMHHIIYDGWSLNIFFGELSQLYTAF
TQGLPNPLPELPIQYADFAFWQRQWLTGEVLDKQLTYWQKQLTGVPGVLELPTDKPRPPV
QTFRGAVERFSLDSNVTQSLKQLSQESDATLFMTLLAAFLVLLHRYTGQSDIVVGSPIAN
RNNPQVKQLMGFFANTLALRGDLSGNPSFADFLAQVRQTTLSAYTHQDLPFDMLVEKLQP
GRDLSRNPLVQVMFSLQNASQETWDLPGLTIENISLPIDETVKFDLEVNYWEVSGGLEGV
WSYSTDLFDAATIARIAQHFQTLLQAIVANPKAPIAELPLLSPAEHHQLLVEWNNTQVDY
PCDKLIHQLFEEQVERTPDAVAVVFKGQKLTYQQLNNRANQLAHHLRSLGVKPDVLVGIC
VERSLEMVVGLLGILKAGGAYLPLDPDYPQDRLAFMLEDAQAPVLLTQQQLLKKLPEHPG
QVVCLDTEWQSIALSSQENPIAGVQYSNLAYVIYTSGSTGKPKGAMNTHLGICNRLLWMQ
QAYQLTSADCILQKTPFSFDVSVWEFFWPLMIGACLVVAKPGGHKDSAYLVNLISEEQVT
TLHFVPSMLQVFLEEQNLESCSSLQRVICSGEALSLELQERFFARLDCELHNLYGPTEAA
IDVTYWQCQPDTHLRTVPIGQPIANTQIYILDSYLQPVPIGVAGELHIGGLGLAQGYLNR
PQLTQEKFISNPFSFDPNSRLYKTGDLARYLPDGNIEYLGRIDSQVKIRGFRIELGEIEA
ILNQHGDVQAACVIVREDHPGDKRLVAYVVAHPDCTPTISELRQFIKATLPEYMVPSAFV
LLESLPLTPNGKLDRRALPKPDLDSTQLEKYVAPRTPIEEMLVQIWAQVLKVEQVGIHDN
FFELGGHSLLATQLVSRIRNVFKVELPLRELFANATVAELAPSIGQLQQQDLELSTAPIV
PRVNNAELPLSFAQQRLWFLDQFNPNSAFYNIPTALRLVGTLNISALKQSLQEIIHRHEA
LRSNFIAVDGQPTQVIRGLGAGDWGLGIVSVVDLQHLSTTEKEIATQQLAKQQAIQPFDL
ATQALVRVTLVVLSETEQVLLLCMHHIVSDGWSIGVFIQELAALYNAYSHGQTSLRDATR
TPLAPLPVQYADFAIWQRQWLQGDVLQRQLSYWEQQLKDAPALLSLPTDRPRPAVQTDNG
AYQEFALSAELTDRLVKLSQEQGCTLFMTLLAAFDTLLYRYTGQEDILVGSPIANRDRSE
IEGLIGFFVNTLVMRANLAGNPSFCELLTRVREMAMEAYSHQHLPFEMLVEALQPERDLS
HTPLFQVMFVLQNAPTSQVELTGLTVSPFPMKGANARFDLTLIMQNTASGLVGVWEYNTD
LFDASTIERMTGHFVTLLAGIVANPEQPIAQLPLLTPPEKQKLLVEWNDTQVDYPLDKCI
YQLFEEQVERTPNAVAVEWGNQQLTYQQLNGRANQLAHYLQSLGVKADVLVGLCVERSLE
MVIGLLGILKAGAAYVPLDPEYPPERLSFILEDAQVSVLLTQQSLVDRLPQHQAKLICLD
TDARLITHNSQENLICSVKTNNLAYLIYTSGSTGQPKGIAMNQLALCNHILWHQDNLKIA
RGAKTLQFASISFDVSFQEIFTTWCSGGTLFLITEELRRDTSALLDFLQEKAIERIFLPF
VGLQQLAEVAVSNGCVNTHLREIITAGEQLQITPAISQWFHKLTNCTLHNQYGPSESHLA
TSFTLSDAVETWPVLPPIGRPIANAQIYILDKFLQPVPVGVPGEVYIAGVLLAQGYFNRH
ELTQEKFIPHPFETVEGKKLYKTGDLARYLPDGNIESLGRIDNQVKIRGFRIELGEVEAV
LSQYGDVQASCVVVREDTPGNKRLVAYVVPEKQQILSVREVRDFLKEKLPEYMLPSAIVI
LDALPLSPNGKLDRRALPAPDLHSQLSDKYVAPRNPTEEILAGIWAQVLKLEQVGIHDNF
FELGGHSLLATQLISRIRTTWNIELPLRSLFAAPTVAELSANIQQLQQQDLEPTASAILP
RTRNTKLPLSYAQTRLWFLDKLNPNSSFYNIPIALRLAGTLNRTALEQSLQEIIGRHEAL
RTNFLTVDGQPIQVIRELGTGDWELGTRDWGLGIVSVVDLQDLSTTEQENALKVLAQQQA
QQPFDLAKQLLVRAALVLLSETEHALLVCIHHIVFDGWSIGVFFQELAALYDIYSQFQPS
PLAPLPIQYPDFAIWQRGWLQGDVLQKQLSYWQQQLANAPSLLSLPTDRPRPAVQTFAGA
YQEFALSGELTDRLVKLSQEQGCTLFMTLLAAYDTLLYRYTGQSDILVGTPIANRDRSEI
EGLIGFFVNTLVLRANLAGNPSFSELLTRVREVALGAYAHQHIPFEMLVEALQPERNLSH
TPLFQVMFVLQNAPASQLELTGITANPIKVKSTTTKFDLTLIMQNTASGLVGVWEYNTDL
FDASTIERMTGHFVTLLEGVIANPQQPISQLPILTTVEQQQLLVEWNNTQTDYPADKCIH
QLFEEQVERTPDAVAVVFGNQQLTYHQLNCRANQLAHYLRSLGVKPDVLVGICVERSLEM
VVGLLGILKAGGAYSPLDPGYPPERLSLMLEDAQVSVLVTQQHLIERLPQYQAKLVCLDE
AWEQIAQNSQDNPTSEVKACHLANLIYTSGSTGRPKGVMVEHKGLCNLAQAQIQTFGLTP
DSRVLQFASFSFDAAIWEIVMALMSGGRLYLATKDALLPGKPLIERLRDYSITHITLPPS
ALAVMPVSELPELQTIIVAGEACAAELIRQWSVGRNFFNAYGPTEATVCATITQCHNNEK
ISIGRAIANTQVYILDENLQPVPVGVPGELHIGGVGLARGYLNRPELTQEKFIPHPFEKS
KLYKTGDLARYLPNGNIEYLGRIDHQVKVRGFRIELGEIETVLSQHDDVQICCVIAREET
PGNKTLVAYVVPQKDVTLTTGEMRQFLADKLPGYMVPATFVILPSLPLTPNGKVDRRALP
DPNLHQELSDYVTPNTELERIIAGIWQQVLGVEKVGIYNNFFELGGHSLLLVKINQQLQE
EFGLELSIIDMFNYPTVHSLSQHLNNNIHKKNTVTQQNNSRPQSHSEIKDLKNRQLQSRQ
QHRAQRKR
Download sequence
Identical sequences A0A1W5CBS0 Q3MCQ2
240292.Ava_1611 gi|75907833|ref|YP_322129.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]