SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CD24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CD24
Domain Number 1 Region: 11-384
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.88e-87
Family Cystathionine synthase-like 0.000000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CD24
Sequence length 395
Comment (tr|A0A1W5CD24|A0A1W5CD24_9NOST) Aminotransferase {ECO:0000313|EMBL:OBQ03300.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_23735 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MKKITSTNKLDCIYFDYHSTTPVDQRVAEMLLHYMTTEFGNASSIDHIYGDMAKEAVAQA
SVNVANLVGASSKEVIFTSGATESINLVIQSNVSNNNSTKIRPRIAVLPVEHKAVLDTCN
MIAKKNLADIINLQIDSKGRLNLDFLNKICDSGISLICIMAANNEIGNIYPIQEIGQIAR
KYNIPFLCDASQAVGKIPINFEEWGITYLALSAHKLYGPKGSGALVVRKGHQLNPILFGG
GHQKGLRSGTLNVPGIVGLGEACRLRILEMDEDEKAIANLRDKLQNLLLDKVPGLVINGD
VNNRLSGNLHISIPDVSNSAIIARVRQKLAISTGAACSSGVQAPSHVLQAMDLPTDIIDG
ALRIGIGKFTKLEEIEQAAEILSLAVQQTRQVMYC
Download sequence
Identical sequences A0A1W5CD24 Q3M1X2
gi|75812584|ref|YP_320203.1| 240292.Ava_B0304 gi|75812584|ref|YP_320203.1|NC_007410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]