SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CDL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CDL2
Domain Number 1 Region: 435-1000
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.09e-156
Family Acetyl-CoA synthetase-like 0.00000000336
Further Details:      
 
Domain Number 2 Region: 1051-1335
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.15e-68
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.00083
Further Details:      
 
Domain Number 3 Region: 195-461
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2e-30
Family NRPS condensation domain (amide synthase) 0.052
Further Details:      
 
Domain Number 4 Region: 12-189
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 6.78e-23
Family NRPS condensation domain (amide synthase) 0.034
Further Details:      
 
Domain Number 5 Region: 980-1053
Classification Level Classification E-value
Superfamily ACP-like 3.27e-20
Family Peptidyl carrier domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CDL2
Sequence length 1345
Comment (tr|A0A1W5CDL2|A0A1W5CDL2_9NOST) Non-ribosomal peptide synthetase {ECO:0000313|EMBL:OBQ03916.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_22730 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MHTEMTNLIRISPQQKHLWLQQKDNYQAYCTQIAINITGNLNSDILKLALANLSDRYEIF
HTAFHSLPGMNIPFQSISDAPTYNHISLAEYDWSRLSSQVQKAKIDTLFQDTSLRVFDFE
QATNLHFILGKLATDQHILFISLPALYADKTTLNYLICEIGRAYTACLDGEEISEEVMQY
ADVSEWLNELLESEDTETARNYWQQQDISSVLNLRIPFEIKNDHQSSGEISFAPQSLCLA
MNRDTVEKLEILQESYHTSTEAILLACWQVLLWRLSGQSEIVIGAAGDGREYDELKGVFG
LLTKYLPIHSRLEDALKFSELMERVSESLRFVKKWQEYFNWENFISTNEKFAARPFFPFC
FDFTQQSQSYVNGNIAFSEYKKSANIDKFQIKLSSGYSQDNLVVNFDYDANLFSEDSIKI
LAEQYLTLIASVTYNPEAAIIDLNMISESDRQKLLIDFNNTKIEFPHDKCLHELFAAQVE
RTPNNIAVEFNHESLTYAQLNAKSNQLAHHLQKLGVKPEVLVGICVERSLDMLIGILGIL
KAGGAYIPFDPTYPQERLGFMLEDAQIPILLTQQRLVDKFVEHKTQIICLDRDLPENATL
SIDNPVSNVTSENLAYIIYTSGSTGKPKGTMIPHRGLVNYLSWCTNAYALAQGYGAPVQS
SIGFDATITSLFSPLLVGKRVVLLPEKEEIEALSALLQSDQNYSLVKITPAHLEMLNQML
PNHKGVTETRALIIGGEALLGKSLNFWRDNAPKTRIINEYGPTETVVGCCVYEVDEQTSL
SGAILIGRPIANTQLYLLDDKQKLVPIGVPGELYIGGAGVARGYLNRPELTQQRFIPNPF
SDEPNSRLYKTGDLARYLPDGNIEYLGRIDHQVKIRGFRIELEEIESLLAQHPLVNAVTV
IAREDQPGDKRLVGYIVPKEQAPTSSELRQFLQSKLPEYMIPSAFVMLEVIPLTTHGKVD
RQALPQPDTSRLDTLKVEFIAPRDRLELKLANIWENLLNVHPIGIKDSFFELGGHSLLAV
RLMAHINQEFGKNLALATLFQNPTIEKLANLLRQTSEISSWSPLVEIQTGNSQYPFFCLP
GGGGNVLYLHELARDLGSEQTFYGLQAPGLNGESDPLTSVEEMAAYYIQAIQSVQPEGPY
FLGGHSFGGIVAYEIAQQLVKSGHEVALVAILDAPAPVASDKPIYIDVDDATRLTETARL
IERWAGKSLNISYEILQPLELDAQLEYLKEQLIAVGLLPTGTETKQVRGLVQVFETNLQA
SIKYSPQEVYPHRLTLLRAREVNAEDAALLTELRQDPAWGWGQFSTEKVDIHIVPGDHMT
MMTQPHISSVAKQLRICIEQTNVGS
Download sequence
Identical sequences A0A1W5CDL2 Q3M5N4
gi|75910301|ref|YP_324597.1| 240292.Ava_4101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]