SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CDL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CDL5
Domain Number 1 Region: 8-195,296-383
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.68e-82
Family Bacterial dinuclear zinc exopeptidases 0.0000232
Further Details:      
 
Domain Number 2 Region: 181-294
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 7.72e-28
Family Bacterial exopeptidase dimerisation domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CDL5
Sequence length 392
Comment (tr|A0A1W5CDL5|A0A1W5CDL5_9NOST) Peptidase M20 {ECO:0000313|EMBL:OBQ03909.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_22695 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MAHVLTSEKVFPRMVELRRYLHSHPELAFEEKKTASIVIDELKRLGIPFWYGGVGSGIIG
KLINAGQRAPTIALRADMDALPGQENTGLPFASLHPGKMHACGHDGHMAMVLGAAALLKE
NPPPGNVVFIFQPAEEKGAGAKVMIQSGALEGVNAIFGGHVTRHYQVGEIMVAKGVITAQ
SDGFTIRVKGRGGHGARPHEAVDAVVVAGLLIMAVQTLVSREINPAYPSVVTIGKVEAGS
AGNVIAEEAILEGTIRTTNLDVQNHIIDGLKRIATAVGELHNARVEIEIRHGYPPVINTG
KETEIARRAIVDILGSKGLVTMDYPSMGAEDFSFYLLHVPGCYVRFGACQQGCENIPLHS
PSFDFDEEALKVGAAFFDRVVREAIAEYADNS
Download sequence
Identical sequences A0A1W5CDL5 Q3M5P1
gi|75910294|ref|YP_324590.1| 240292.Ava_4094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]