SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CEL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CEL9
Domain Number 1 Region: 7-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.98e-66
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000627
Further Details:      
 
Domain Number 2 Region: 187-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.18e-39
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CEL9
Sequence length 327
Comment (tr|A0A1W5CEL9|A0A1W5CEL9_9NOST) Pyruvate dehydrogenase {ECO:0000313|EMBL:OBQ04809.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_20805 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MAETLFFNALREAIDEEMARDSSVFVLGEDVGHYGGSYKVTKDLYKKYGELRILDTPIAE
NSFTGMAVGAAMTGLRPIIEGMNMGFLLLAFNQISNNAGMLRYTSGGNFKIPLVIRGPGG
VGRQLGAEHSQRLETYFQAVPGLKIVTCSTPYNAKGLLKSAIRDDNPVLFFEHVLLYNLK
EDLPEKEYYLPLDKAEIVRSGKDVTILTYSRMRHHVTQAVKALEKQGYDPEVIDLISLKP
LDLETIGASIRKTHKVIIVEEAMRTGGIAAELIASINDRFFDELDAPVLRLSSQDIPTPY
NGTLERLTIVQPEQIVEAVQKMIALRV
Download sequence
Identical sequences A0A1W5CEL9 Q3MD22
gi|75907713|ref|YP_322009.1| 240292.Ava_1491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]