SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CGE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CGE4
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily L28p-like 1.8e-25
Family Ribosomal protein L31p 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CGE4
Sequence length 79
Comment (tr|A0A1W5CGE4|A0A1W5CGE4_9NOST) 50S ribosomal protein L31 {ECO:0000256|HAMAP-Rule:MF_00501, ECO:0000256|SAAS:SAAS00804274} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_16915 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MAKSDIHPKWYPEAKVYCNGQVVMTVGSTKPELHVDVWSGNHPFYTGTQKIIDTEGRVER
FLRKYGMSSTQTSGEQNKK
Download sequence
Identical sequences A0A1W5CGE4 Q3MF92
gi|75906943|ref|YP_321239.1| 240292.Ava_0720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]