SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CGW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CGW4
Domain Number 1 Region: 856-1041
Classification Level Classification E-value
Superfamily beta-Roll 1.31e-29
Family Serralysin-like metalloprotease, C-terminal domain 0.00032
Further Details:      
 
Domain Number 2 Region: 654-722,749-831
Classification Level Classification E-value
Superfamily beta-Roll 4.71e-28
Family Serralysin-like metalloprotease, C-terminal domain 0.0008
Further Details:      
 
Domain Number 3 Region: 555-654
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-26
Family Dystroglycan, N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CGW4
Sequence length 1055
Comment (tr|A0A1W5CGW4|A0A1W5CGW4_9NOST) Uncharacterized protein {ECO:0000313|EMBL:OBQ06503.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_17590 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MANTAPLLNNTGNLTLSFITEDIPVTSNTGTLVSEIIGNSISDPDASALKGIAVTFVDNS
NGVWEYTLNNGTSWNAFGTPLLNAARLLPSNANTKIRFRPNANFSGSADINFYAWDQTTG
TSGNTANILAGKGGTTAFSTDYEGASITVTSVNDTAPTLNAGTLTLATINEDTPLVSNRG
SLLADLVRGLISDSDANPQGIAVTGADNSNGSWQYSLDGGANWLNFGAVSDSSATVLLPS
IRLYDGSLIGSPTSQGWLKFGASPAITLPILGNVLGVGGTQSQISGGTQLNSNTTPASSL
AGFTASTGTSGYSNYNGYAPVLFNQSFPALDPVKGFTISFDVKINSETHTSDDNGDGIQD
RAGFSVIVVTSDKTKAIELGFWTDEIWAQNASPLFTHSTTERAFRNTSTAVTHYNLVVEN
NTYKLFAPDSSTPILSGNLRDYTAFNHTTAAPSPINSLPFDPYETPNFLFLGDNTTSARS
SIDLTRVELQTNTRVRFVPNADYNGQANLTFRAWDGSNGVASGTTGVNASVNGNATAFSS
NTQTVGITINSVNDAPIVANSISNQTAITGTAFNFQIAANTFADADSGDTLTYSATRSDG
SPLPSWLSFDADTGRFTGTPTTDNLGSISLRVTATDTTNLSVNTIFNLEIRRPDNIINGT
ANNNTIIATSAKDIFDGGDGGDIFITNIANLSQNDILNGGNGQDTIIIQGGINTDTISFD
LSNVNNQLASILGTTITNVETFDLRSFAGTVTFTGGSGNDVVYGGVGNDTLTGGAGDDNL
NGGAGDDTLIGGDGNDILTGGSGTNTLTGGAGNDRYYIDNASDVIQEGAGAGQDEVFATV
SYTLAANVEALTLRGTAIQGTGNSSNNNIRGNNANNILSGEDGNDNLTGNAGNDVLIGGR
GNDTLNGGIGNDELIGGAGSDRLFGGAGADYFSFGSQGNPFNSGDFGIDTIADFAVGVDD
IKLDKVSFSALTSVVGNGFSVSSEFASVSNDTLAATSNGLIVYSLGSGRLFYNQNGSAAG
FGTGAQFATLSGTPILSADDFFIFQSVQEPAKKIA
Download sequence
Identical sequences A0A1W5CGW4 Q3MFM9
240292.Ava_0583 gi|75906806|ref|YP_321102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]