SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CHQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CHQ6
Domain Number 1 Region: 7-430
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.53e-134
Family GABA-aminotransferase-like 0.00000000000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CHQ6
Sequence length 432
Comment (tr|A0A1W5CHQ6|A0A1W5CHQ6_9NOST) Glutamate-1-semialdehyde aminotransferase {ECO:0000256|HAMAP-Rule:MF_00375} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_14010 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MVNTTIKTTKSQEIFAAAQNLMPGGVSSPVRAFKSVGGQPIVFDHVKGAYIWDVDGNQYI
DYVGTWGPAICGHAHPDVIGALHEALEKGTSFGAPSFLENVLAEMVIAAVPSIEMVRFVN
SGTEACMAVLRLMRAFTNREKVIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPKSAT
SSTLTAPYNDLEAVKALFAENRDQIAGVILEPVVGNAGFITPDAGFLEGLRELTHEHGAL
LVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRRDIMSMIAPAGPVY
QAGTLSGNPLAMTAGIKTLELLQKPGAYEYLERITKKLADGLLQVAQETGHAACGGHISA
MFGLFFTSGPVHNYEDAKNSDTAKFGRFHRGMLERGVYLAPSQFEAGFTSLAHTDEDIDQ
TIAIAREVLSSI
Download sequence
Identical sequences A0A1W5CHQ6 Q3M3B9
240292.Ava_4920 gi|75911116|ref|YP_325412.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]