SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CHV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CHV4
Domain Number 1 Region: 12-348
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.1e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CHV4
Sequence length 439
Comment (tr|A0A1W5CHV4|A0A1W5CHV4_9NOST) Pyridine nucleotide-disulfide oxidoreductase {ECO:0000313|EMBL:OBQ07090.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_14350 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MVDLHEKKAPHQVVIVGGGFGGLYTAKTLAKANVSVTLIDKRNFHLFQPLLYQVATGTLS
PGDISSPLRAVFSKSKNTQVLLGEVKDINPKAQHVILDDKVVPYDTLIVATGANHSYFGK
DHWKDLAPGLKTVEDAIEMRRRIFGAFEAAEKETDPEKRRAWLTFVIVGGGPTGVELAGA
IAELAYKTLKEDFRSIDTSETKILLLQGGDRILPHIAPELSQVAAESLQKLGAIIQTKTR
VTNIENDIVTFKNGDEVKEIPSKTILWAAGVKASPMGEVLAERTGVECDHAGRVIVEPDL
TVRGYKNIFVVGDLGNFSHQNGKPLPGVAPVATQQGEYVAKLIKKRLKGQTLPEFRYNDV
GSLAMIGQNLAVVDLGLIKLQGFIAWVFWLLIHIYFLIEFDTKLLVVFQWAWNYITRNRR
SRLITGREAFVEPKTVNQQ
Download sequence
Identical sequences A0A1W5CHV4 Q3M345
gi|75911190|ref|YP_325486.1| 240292.Ava_4994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]