SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CJD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CJD9
Domain Number 1 Region: 4-407
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.51e-89
Family AAT-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CJD9
Sequence length 407
Comment (tr|A0A1W5CJD9|A0A1W5CJD9_9NOST) Succinyldiaminopimelate aminotransferase {ECO:0000313|EMBL:OBQ07943.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_12125 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MTNMQFSQRLQPLQSNVFADMDKAKALALAAGKELIDLSLGSSDLPAEAHVIEAIAKSLY
DPSTHGYLLFNGTRDFRQAAANWYEQKFGVKVDPETEVLPLIGSQEGTAHLPLALLNPGD
FALLLDPGYPSHAGGVYLASGQIYPMPLKAENDFLPVFTDIPTDVLARSRMMVLSYPHNP
TAAIAPLSFFKEAVAFCQEHNIALVHDFPYVDMVFEDSSNWDQNLSQSPIPNHRSLVPSI
LQADPDKSVSIEFFTLSKSYNMGGFRIGYAIGNAQMIQALRQIKAAVDFNQYRGILNGAI
AALTGPQAGVEAAVSTFRQRRDAFIHALHHIGWYVPTPKATMYIWAKLPSSWSQNSIEFC
TQLVKQTGVAASPGAGFGKSGEGYVRFALVHEPSILRTAVERISNFL
Download sequence
Identical sequences A0A1W5CJD9 Q3MGV1
gi|75906384|ref|YP_320680.1| 240292.Ava_0159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]