SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CJV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CJV5
Domain Number 1 Region: 23-348
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.54e-73
Family AAT-like 0.0000769
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CJV5
Sequence length 350
Comment (tr|A0A1W5CJV5|A0A1W5CJV5_9NOST) Imidazole acetol-phosphate transaminase {ECO:0000256|HAMAP-Rule:MF_01023} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_10760 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MTNYFRSNVEAMASYVPGEQPPRGTQVIKLNSNENPYPPSPAALAALQDIDGEWLRRYPE
PLGGEFREAASKVLGVPSDWLIVGNGSDEILSIVIRACTEPGRKVVYPMPTYVLYRTLTQ
MQAADILEIPYQENNVLPVAELIAADGAVTFIASPNSPSGHIVPNDDLRKLASELSGVLV
IDEAYVDFAEESALDLVQEYENVILIRTLSKGYSLAGLRLGFGVGNPKLLDGLFKVKDSY
NIDAIACKVAAVAITDQAYKNSCVAKVKASRTQLTKDLKQLGFHVWDSHGNFLLTKPPEG
NAEYLYEKLKEQKILIRYFQQPGLEDKLRITVGTDEQNHILVRALRDLLR
Download sequence
Identical sequences A0A1W5CJV5 Q3M504
gi|75910531|ref|YP_324827.1| 240292.Ava_4334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]