SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CJZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CJZ4
Domain Number 1 Region: 7-46
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000318
Family Rho termination factor, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CJZ4
Sequence length 416
Comment (tr|A0A1W5CJZ4|A0A1W5CJZ4_9NOST) Rho termination protein {ECO:0000313|EMBL:OBQ08421.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_11080 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MAKERPPLEEMTLRQLRRVASEFSISRYSRMRKSQLLAAIQEVQRNKALLNPSRSLEAQE
TVEAAKFELGQEDRTGGSLADVDEGLADLPGGYGDSRIVLLPRDPQWAYAYWDIPNDHKE
ELRRQGGQQLALRIYDVTDVDLDYQSPHSIQEYPADELAREWYIPIPVSDRDYVLDIGYR
AVDGRWLVLARSARVHIPPVYPSDWIEDVFISVNFEEDLRGKTLYELVPPAKKAPTVAAG
ANGSNPIYDHIFGLAESAEAQRVAGSLFGSQQHVAGSVRPEQAISSYIFPSGVGMWAVPT
SSGLNMSGVGMSGVGFSASAIPVRPRQFWLIADAELIVYGATEPDATVTIGGRPIKLNPD
GTFRFQMSFQDGLIDYPILAVAADGEQTRSIHMKFNRETPSRNTNTKEEAVVEWLS
Download sequence
Identical sequences A0A1W5CJZ4 Q3M564
gi|75910471|ref|YP_324767.1| 240292.Ava_4273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]