SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CKU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CKU1
Domain Number 1 Region: 127-486
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.52e-87
Family AAT-like 0.0000234
Further Details:      
 
Domain Number 2 Region: 8-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.65e-21
Family GntR-like transcriptional regulators 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CKU1
Sequence length 490
Comment (tr|A0A1W5CKU1|A0A1W5CKU1_9NOST) Aspartate aminotransferase {ECO:0000313|EMBL:OBQ09008.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_09225 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MDFAINIDPDAPLPLHRQVYEELRRAILLGRLISGEKLPSTRSLAQLLGVSRATVTQGYE
LLLSEGYLETIVGSGTFVCRQLPDELLNTAPIESKLQPNNSPVPLSAYGKSLSDKAFLCI
PEQAVEISFSYGRPAFDKFPIDLWRKLISRHCQLKPNVLDYTDNSLGYQPLREAIAAYLS
RSRAVNCQAEQIIIVGGSQQGLDLITRILIDRGDGIVVEEPGYLGARRAFLAQGASLFPV
PVDQSGLIVNKLKTSIIPNLKLVYVTPSHQFPTGAVLSLPRRLELLAWAQKAGVMIIEDD
YDSEYRYGERPIPALQGLDQGNSVIYVGTFSKVLFPALRLGYLVLPQNLVNIFARAKWLA
DRQCSLLEQYALTDFITEGHLERHIRKMRSLYNQRRQTLVQSLFSHFGNRAKILGENAGM
HLMVKIDTQISDDEIVQSAALSGVSIGAAYPQYLKDSPGSEFIFGYAELNEQQIQEGVRR
LARVIHNSEG
Download sequence
Identical sequences A0A1W5CKU1 Q3MBT1
240292.Ava_1933 gi|75908154|ref|YP_322450.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]