SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CL63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1W5CL63
Domain Number - Region: 79-140
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0294
Family Recombination endonuclease VII, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CL63
Sequence length 181
Comment (tr|A0A1W5CL63|A0A1W5CL63_9NOST) HNH nuclease {ECO:0000313|EMBL:OBQ09202.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_08735 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MAITIPVLEQSVVVFSQNYLPLCRVNIKRAIVLLLTNKAEPLVGYTENGWRVHSPSLIID
VPKHIRLKITSIERTWKVPPVNRREILRRDHHSCQYCGSRKRLTLDHVIPRSRGGSHTWD
NVVTACERCNSRKGDRTPAEVGMQLRTKPKPPVHPAVAFAVSDTWRDNATQFWIDMQANL
E
Download sequence
Identical sequences A0A1W5CL63 Q3M4M8
gi|75910657|ref|YP_324953.1| 240292.Ava_4460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]