SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CLU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CLU1
Domain Number 1 Region: 8-554
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 5.49e-175
Family Acetyl-CoA synthetase-like 0.00000000268
Further Details:      
 
Domain Number 2 Region: 609-884
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.3e-67
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.001
Further Details:      
 
Domain Number 3 Region: 533-606
Classification Level Classification E-value
Superfamily ACP-like 5.76e-17
Family Peptidyl carrier domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CLU1
Sequence length 888
Comment (tr|A0A1W5CLU1|A0A1W5CLU1_9NOST) Non-ribosomal peptide synthetase {ECO:0000313|EMBL:OBQ09840.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_06950 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MQTIDFNIRKLLVEWNATHRDYDLSQSLHELIVAQVERTPEAIAVTFDKQQLTYQELNHK
ANQLGHYLQTLGVQPETLVGVCLERSLEMVICLLGILKAGGAYVPIDPEYPQERIAYMLE
DSQVKVLLTQEKLLNQIPHHQAQTICVDREWEKISTQANTNPKSNIKTDNLAYVIYTSGS
TGKPKGAMNTHKGICNRLLWMQEAYQIDSTDSILQKTPFSFDVSVWEFFWTLLTGARLVI
AKPGGHKDSAYLIDLITQEQITTLHFVPSMLQVFLQNRHVSKCSSLKRVICSGEALSIDL
QNRFFQHLQCELHNLYGPTEAAIDVTFWQCRKDSNLKSVPIGRPIANTQIYILDADLQPV
NIGVTGEIYIGGVGVARGYLNKEELTKEKFIINPFPNSEFKRLYKTGDLARYLPDGNIEY
LGRTDYQVKIRGYRIEIGEIENVLSSHPQVREAVVIARDDNAQEKQIIAYITYNSIKPQL
DNLRDFLKARLPDFMIPAAFVMLEHLPLTPSGKVDRKALPKPDLFNYSEHNSYVAPRNEV
EEKLVQIWSNILHLPKVGVTENFFAIGGNSLKALHLISQIEELFAKEISLATLLTNPVIA
DLAKVIQANNQIHNSPLVPIQPQGKQQPFFCIHPAGGHVLCYFKLAQYIGTDQPFYGLQA
QGFYGDEAPLTRVEDMASLYVKTIREFQPQGPYRVGGWSFGGVVAYEVAQQLHRQGQEVS
LLAILDSYVPILLDKQKPIDDVYLVGVLSRVFGGMFGQDNLVTPEEIENLTVEEKINYII
DKARSARIFPPGVERQNNRRILDVLVGTLKATYSYIRQPYPGKVTVFRAREKHIMAPDPT
LVWVELFSVMAAQEIKIIDVPGNHYSFVLEPHVQVLAQRLQDCLENNS
Download sequence
Identical sequences A0A1W5CLU1 Q3M6C6
gi|75910059|ref|YP_324355.1| 240292.Ava_3855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]