SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CM58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CM58
Domain Number 1 Region: 671-1190
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.44e-151
Family Acetyl-CoA synthetase-like 0.0000000473
Further Details:      
 
Domain Number 2 Region: 1387-1626
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.22e-39
Family NRPS condensation domain (amide synthase) 0.033
Further Details:      
 
Domain Number 3 Region: 307-558
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.22e-30
Family NRPS condensation domain (amide synthase) 0.0056
Further Details:      
 
Domain Number 4 Region: 1196-1395
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4e-28
Family NRPS condensation domain (amide synthase) 0.022
Further Details:      
 
Domain Number 5 Region: 127-298
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.22e-23
Family NRPS condensation domain (amide synthase) 0.022
Further Details:      
 
Domain Number 6 Region: 579-677
Classification Level Classification E-value
Superfamily ACP-like 0.00000000262
Family Acyl-carrier protein (ACP) 0.024
Further Details:      
 
Domain Number 7 Region: 6-84
Classification Level Classification E-value
Superfamily ACP-like 0.00000034
Family Acyl-carrier protein (ACP) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CM58
Sequence length 1643
Comment (tr|A0A1W5CM58|A0A1W5CM58_9NOST) Non-ribosomal peptide synthetase {ECO:0000313|EMBL:OBQ09960.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_07605 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MSTKSLELPIFSLVAKITGHDAEDLERDMFLEGNLGLDSIKMMELLNGLVALIPQEIQPK
FMETLPLQNLMQLQTLGDVVQIADNCLISPIDNSDSSPSASIINQEQQKTEKVEILSGQY
FHLLGHWVVNSISLFSTLRLRGDFDTKVAWQSWKDLLNRHPMLRSRFIIPPDTTRFKDYE
MVVMENPTPPDIPVTDIRHLHSEAQEQLINDELHRCLNYEWQMTEWPLHRFFVFRLEDSV
YQLVLANEHLISDALGCHVILREFMEIYRAHVCGEQPNLQPPTTVQDYSELVQSINAWQD
PEEDKALVEYVNRRGKDSYLWNPTGNTITSLCPKFHNRRFSLGKAITGQLIAQTREWRLP
LNSLLVGAFVRAVAKFEQSKNEPIMVQVPTSGRVYPGIDASDVVGSFAQNLSISLDLPTP
NEDWQRLLNRVHQEIQQGLVNGYDRAQTRQMAIAFRDNIVLEDGKIPERMLPMYRRILKS
NLYCPFTGQTNIKNKYGPIDVIDYRAGGINAAGTIDILQEIFDDSLHLFASYDSNFFPES
VIDELMQEYITQIQELASLKISSEQLTQPLPKTQTDVNIAQLLQDIATEICHSQITDNDM
AKDLEAELGMDSLELIRIVTRLEKRLGKVNRQALLSCRSLQEMAVLLGKKQSSSLQQQSV
VNNQQPQEIPYWEIIEQAKRTPNAVAVTDGETQITYAELNRLSNQVANYLQAQGVKPGVF
VGIMTRRGPLMFVGILGILKAGGTYVPLDPIYPHERIKYILEHAQIGILLTENRLTNKLA
ECLTEQLPLKTLMFLDEGVFEQGKAWTQLNKKTWARCSDIAPANVNTPDDLMTVLYTSGS
TGKPKGVMLNHRGYMNRLVWMQNAFQLRYGDRVAQKTSCCFDISVWEIFWPLMVGATVYS
VETETVKNPWLLAQWIQDNQINVMHFVPSLFGEFCHALESESWTFPDLRWLVFSGEALPV
PFVQRWIDKYGMSVGLANLYGPTEASIDVTAHIIRQRPGEQEICIPIGKAIDNVYILILD
EQMQPLAPGKMGELWIGGVQLAKGYLKDPQRTADAFRLNPFSHVPGEYLYKTGDLAVELP
DGSFEYHGRIDHQIKIRGFRVELGEIESVLNSHPVISEAAVLAVDYENGQKRLIACLAGS
QVDNQQIKEFLAQRLPDYMIPHRWEWLASLPKTHNGKLDRKAILAAITQEKPTVSQEYLP
LGPAQRWLVKYFEAPYQWNGYTRFLFHQPLDPEIFNQALNIVLEAHPALRTVFVQRDQQW
WQQLISPEQKLSAEFYDGSYLTSAQRDSEIHNRIQEIAQQFQIDQWPLMKVIAIKVNESC
YDISLVGHHIIGDLLSTGVIFNQLWLTYSELLGNRTQISQPLPATPSYIDYVRALMQAEQ
QGALRSHVDYWKSQFPSQEYTFQVPFDYQKGANLEASAASEKFTLSKNSSNILLREAKQY
YKCNVYTLLLSTLYQLMAEWSGQHWVVVSHRSHGRNLDSKHTFLNSVGNFAMNFPVGVNL
ERSIRWEQTTKEIQAKFNELPMNGITFDWISEQLPHYVYPDNNLTPVRANYLGNRTAPSS
ELFEFIEEDRDSRLSSPDQKRTALLEFFFSITDGTVHLEIEYSRNFHLPATIRRLGDRYL
ELMAQMLAVVSLVGNGIDVTNHS
Download sequence
Identical sequences A0A1W5CM58 Q3M5Z7
gi|75910188|ref|YP_324484.1| 240292.Ava_3984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]