SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W9W4K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W9W4K6
Domain Number 1 Region: 391-511
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.1e-19
Family Heme-binding PAS domain 0.028
Further Details:      
 
Domain Number 2 Region: 338-393
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000196
Family HAMP domain 0.0067
Further Details:      
 
Domain Number 3 Region: 560-788
Classification Level Classification E-value
Superfamily PP2C-like 0.00000301
Family PP2C-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W9W4K6
Sequence length 788
Comment (tr|A0A1W9W4K6|A0A1W9W4K6_9CHLR) Uncharacterized protein {ECO:0000313|EMBL:OQY43347.1} KW=Complete proteome; Reference proteome OX=1972460 OS=Anaerolineaceae bacterium 4572_78. GN=B6242_14835 OC=Bacteria; Chloroflexi; Anaerolineae; Anaerolineales; Anaerolineaceae.
Sequence
MNILNQSSKFDFLDNLNIGRKLGLAFSLLIMLSIIFGVMLFVMENLVKTMFEEVHNADKV
ASLARQIEVELLEMRRNEKNFLLRYSGQSFEGAYGNYVLPNQQHFQTLLDLLTEIRSIIP
AETEREVRYASFLDKLETATHDYQTVFNNLVENIRIRGDQNYGLTGDVLEMLDTLDKEID
ETNESDIKITSSNLRKAYLSYLHFGFQSTGYNYTEQPVQKHIDNFREGTKQLQTLIKSHN
NLSASKRENLSIITKEIQSMFEQLLMLDNEIIEHEKQLAMNARSITTLAGRIISNEEERQ
TETFAEFITLQNRYVIAGIVLFITTILSSVILAVIFTRSIAMPITHLTAIATQIAQAPTL
DAWTGKFDLTRQDEIGMLAKDFNYMTIRLQTLIADLQEREQKYRTIFEESKDVLFVTTAE
GQLIEVNPACKEIFGYTIEEAKLLNVVSFYAFPEDRQRFRNAVESEGFVKNLNLKMRRRD
DKIIDCLVSATLHYDPSGNFMGYQGIIHDMTAQKHVETERLKLTAIRRELSIAKNIQHNL
LPPNKPNWHGVEVVCFTQSAQEIGGDLYAYHAFPPTLDPMTGEVIGGRYGIAVGDVSGKG
ISAALLMALTMSTFKSTVQQFLEPPDLLAQMDKTLMTYTKKSRQNCAFVYVEFDIDLTGI
RRGTMVNAGCSMPLIRRHDGTVDEIEIGGMPLGVGLGSQSGYMSTEVELQRDDMVILMSD
GLPEAMNEHNEMFGFERLMYAVKSFSNQDLKGFQNISGLMLEHIKDKVMAFIGDAEPHDD
LTIVVVQV
Download sequence
Identical sequences A0A1W9W4K6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]