SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X0BZ54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X0BZ54
Domain Number 1 Region: 5-497
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.75e-113
Family Acetylcholinesterase-like 0.00000626
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X0BZ54
Sequence length 502
Comment (tr|A0A1X0BZ54|A0A1X0BZ54_9MYCO) Carboxylic ester hydrolase {ECO:0000256|RuleBase:RU361235} KW=Complete proteome OX=1249101 OS=Mycobacterium celeriflavum. GN=BST21_05005 OC=Mycobacterium.
Sequence
MHEHTVRATISSGTVEGFTRDGVNRWRAIPYARPPVGPLRLRAPQPVQPWRGVRYCHGYG
NCAPQQRMYTMLAPGKYQPMSEDCLTLNVVSPKKRSESALPVMVFIHGGGYFMGSSATPI
YDGAALARNGCVYVSVNYRLGALGCLDLSSLSNKDVTFDDNLYLRDLVMALTWVRDNIAV
FGGDPDKVTIFGESAGAHAVATLLAVPAAKGLFAQAISESPAAGMVRTPEVAAQYATRFA
ALLGAGEHDGADTVMAARPAALVNAFERLVKQGQREMLGAFAAGPTSGTDYLPLDPIEAM
RSGKAHRVPLIVGTNAEEARLFGRFLKLLPMSEPMIERLLAETEPEERERITAAYPGYPD
QTACIQFGSDFAFGSAAWQIAEAHSRHAPTYLYRYDYAPRPLRWSGLGATHATELLAVFD
VYRTKFGRLLTAVGDRRTALRVSNDVQHRWREFARTGVPGADWPAYTTADRAVRVFDQRP
RIEYDPHAARREAWEGFSLAAR
Download sequence
Identical sequences A0A1X0BZ54
WP_067222936.1.21935 WP_067222936.1.39660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]