SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X0BZI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X0BZI9
Domain Number 1 Region: 39-523
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.43e-114
Family Acetylcholinesterase-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1X0BZI9
Sequence length 525
Comment (tr|A0A1X0BZI9|A0A1X0BZI9_9MYCO) Carboxylic ester hydrolase {ECO:0000256|RuleBase:RU361235} KW=Complete proteome OX=1249101 OS=Mycobacterium celeriflavum. GN=BST21_07020 OC=Mycobacterium.
Sequence
MPSRCLRRIRATAALLAAAGLLAGCAGKETAAEGVPVDPGVVQTAAGAVRGTVAADHRYF
AGIPYAAAPVGVLRWRPPAPVGSWTGFRDATRPGARCIQDTSSDVDHRPPSEDCLTLNVW
TPPPASDAKPVMVWIHGGSFLNGSGDIYRARELASRGVVVVTMNYRLGALGFLAHPAFGS
EGDVGNYGLADQQAALRWVRDNIAEFGGDPDNVTIAGESAGGMAVCDHLVAPGSEGLFSA
AIIQSAPCQAQYDLPAAQQASAAYAAGIGCADPLVAAQCLRSLPADRFRAPLTYAGFGTE
RVSGPVAGTPALPENSFTAITSGKATRVPVMIGTNEDEFALFAALQFLRGRPFDAAHYPE
LLAEVFGPHAAAVAARYPPDRYGGNVALAYSAAVTAAEFACVADRMADALSGQPVYAYEF
GDDDAPAPEPLRAAPFPIGAAHSLELRYLFDVGGAPPLKPAQQQLSDEMIDYWARFVTTG
SPGPDWPQLTTAQAGERMLLEPNASHVVTDFEQRHQCAFWASLPA
Download sequence
Identical sequences A0A1X0BZI9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]