SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X0QKA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X0QKA6
Domain Number 1 Region: 141-357
Classification Level Classification E-value
Superfamily vWA-like 6.67e-16
Family Trunk domain of Sec23/24 0.0085
Further Details:      
 
Domain Number 2 Region: 50-137
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.00000000000000222
Family Zn-finger domain of Sec23/24 0.0018
Further Details:      
 
Domain Number 3 Region: 4-40,362-446
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000000000000314
Family beta-sandwich domain of Sec23/24 0.0031
Further Details:      
 
Domain Number 4 Region: 562-670
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 0.00000994
Family C-terminal, gelsolin-like domain of Sec23/24 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X0QKA6
Sequence length 682
Comment (tr|A0A1X0QKA6|A0A1X0QKA6_9MICR) SEC24 {ECO:0000313|EMBL:ORE00199.1} KW=Complete proteome OX=1081669 OS=Hepatospora eriocheir. GN=A0H76_2014 OC=Eukaryota; Fungi; Microsporidia; Enterocytozoonidae; Hepatospora.
Sequence
MTNSNNNSYYDENTNYDDPCYRCTYNYIPHDIKRYQNIIPVTFSVEFDKKPLPVANENLV
RCQKCLGYVNCYSTVVNPGYKWVCNLCNTMNEVLIPFQFKDKNFRSGDRFEYNSNTFVSS
ALTSKVYEIEAPDNYSFGTSRPPTLIFLIEVTSEANRNNLLSSVVNCIKESLANNDLDSR
TRACFIFFNSCGYVLAKNDTMLVIDETIPKILPDEVFYSIKKDQPDNIFDIDYQNILDYF
PSTTNQLNNILPVLYFISRTFRQGSIFAFISSLPNIDKSKIAVSSALYQNNENYKKVSQD
LYLRNLGVNLFACTRQSLELGVLKVLTTSGGQLFHYSNYDGSEPVYTDKLYCDLNEIFNN
RINYNCWMKIRLSEGCNLKALHGNFVQRKNGVFAYSNFSPSHAINFEISIPDKLETVYAQ
IAMLRINKEGIRSVRVFNIQLLTANSSTPTVEIFNAKQIIMALTFNACYQESLKKFSGGY
YIDRQINSIVKEMKISSGGIINENIRPCISYALAMRKSIALRPDKHTPNDFRVFYIYLLS
NMCFSTVDSIVYPTLINLLDPEPTVYSLTRTNLRDDSIYLMDAGITLFCYVGKNCTNLDC
FNNPDTLISGLSLYNITSKNEFGNYMNNWIAYFNEGRLVKPKFVLVLEKESSNYLDVFRS
YFYDDQMYNLPDIFTYENSLGN
Download sequence
Identical sequences A0A1X0QKA6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]