SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X0RHL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X0RHL6
Domain Number 1 Region: 47-128
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000719
Family Duffy binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1X0RHL6
Sequence length 239
Comment (tr|A0A1X0RHL6|A0A1X0RHL6_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORE11509.1} OX=86635 OS=Rhizopus microsporus var. microsporus. GN=BCV72DRAFT_237921 OC=Rhizopodaceae; Rhizopus.
Sequence
MSNENEKSLNLKGSTWPPDYSQYKDLSDDALDQIVENEAQNTQAPEAYKVLFGRLLTYCR
SITESNNRYQQQIHQLNTKCENYLRYIEAARENFENVSELYKEEHIRVLNLREDKLELRL
QIETYKNELKQAAQQLSETQKAREEVIQEHERYKELAGRNAEKQGLGRKNLEETLVEKEQ
QVEELQKAVAQLQNLLSLKEVEIRELNTRNKAISIVLEGTRHLQQQQQQQQQQNHLNFS
Download sequence
Identical sequences A0A1X0RHL6 A0A2G4STV7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]