SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X0RL72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X0RL72
Domain Number 1 Region: 47-126
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000124
Family Duffy binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X0RL72
Sequence length 251
Comment (tr|A0A1X0RL72|A0A1X0RL72_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORE12714.1} OX=58291 OS=Rhizopus microsporus. GN=BCV71DRAFT_259007 OC=Rhizopodaceae; Rhizopus.
Sequence
MSNEGENSLNLKRSTWPPDYSQYKDLSDDALGQIVENEAQNTQAPEAYKALFGRLLTYCR
SITESNNRYQQQIRQLNTKCENYLRYIEAARENFENVSELYKDEHIRVLNLKEDNLELRL
QIETYKNELKQAAQQLFEAQKAREEAIQEHERYKELAGRNAERQGLGRKNLEETLVEKEQ
QIEELQKAVAQLQNLLSLKEVEIRELNTRNKAISIVLEGTRHLQQQQQQQQQQQQQQQQQ
QQQQQNHLNLS
Download sequence
Identical sequences A0A1X0RL72

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]