SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X3IBL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X3IBL5
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily Phage tail protein-like 4.71e-49
Family Lambda phage gpU-like 0.00000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1X3IBL5
Sequence length 131
Comment (tr|A0A1X3IBL5|A0A1X3IBL5_ECOLX) Phage minor tail protein U {ECO:0000313|EMBL:OSK32764.1} KW=Complete proteome OX=656415 OS=Escherichia coli M056. GN=EAMG_03309 OC=Enterobacteriaceae; Escherichia.
Sequence
MKHTELRAAVLDALEKHDTGATLFDGRPAVFDEEDFPAIAVYLTGAEYTGEELDNDTWQA
ELHIEVFLPAQVPDSELDSWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSS
ADLTYVITYEM
Download sequence
Identical sequences A0A1X3IBL5
WP_039720268.1.14749 WP_039720268.1.49321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]