SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X6N3W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1X6N3W5
Domain Number - Region: 105-171
Classification Level Classification E-value
Superfamily RING/U-box 0.000271
Family Variant RING domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1X6N3W5
Sequence length 396
Comment (tr|A0A1X6N3W5|A0A1X6N3W5_9APHY) Uncharacterized protein {ECO:0000313|EMBL:OSX63339.1} OX=670580 OS=Postia placenta MAD-698-R-SB12. GN=POSPLADRAFT_1139948 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
MFARTRARAPSSVQPSGNVASDFEPAFEVATADTRKHRLYKQARALAVRLSIIDDDDVAF
PRAQDTVNNGSQIDGHGNTHVTNTPESLSVRRQGSVGTHRATGPKCVICTNHIYGDEFRA
PCGDFYHRECIVALFEAAVQDKSLVPLRCCGRRIILASVQQFLSPALVELYHAKDKELGT
LKRVYCANPSCRLFLCAHVRGAFWRWLPHRMKYKCCPDCGTVTCTRLDRQDPPPYLGVGG
EVPPPYWAHLRPPPYPDESVLLLLINARQSPTSVARQPPQRNVTARAAACPSLPRTSVAR
QPPQRNVMACAAAAHPPRPRACAALQPLQRNVMARAAATQELPGAVNCTSSWTYVAGTLK
RFAPRHQKSLADSELPVLATKEVLIPQMNKRTARVE
Download sequence
Identical sequences A0A1X6N3W5 B8NZZ4
104341.JGI100283 XP_002468933.1.31404 jgi|Pospl1|100283|fgenesh3_pg.2__181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]