SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X6N3W6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X6N3W6
Domain Number 1 Region: 122-172
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000106
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  A0A1X6N3W6
Domain Number - Region: 1-30
Classification Level Classification E-value
Superfamily RING/U-box 0.00777
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Domain Number - Region: 60-112
Classification Level Classification E-value
Superfamily RING/U-box 0.038
Family IBR domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X6N3W6
Sequence length 173
Comment (tr|A0A1X6N3W6|A0A1X6N3W6_9APHY) RING-type E3 ubiquitin transferase {ECO:0000256|SAAS:SAAS00970528} OX=670580 OS=Postia placenta MAD-698-R-SB12. GN=POSPLADRAFT_1100593 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
CGHYFDVPCLINLVEVATRDESLFPPSCCHQRILDRSFTRFMPSALRDVFAVKDVEFSTT
CRVYCAKPSCSRFLGARRKDSFAPVLSCPSPGCGTHTCSRCRGAVHPGRGHRCEHDSGQK
AVLELASQKGWARCPACDQMIELRSGCYHMTCVCAVQFCYLCKSLWKTCHCPR
Download sequence
Identical sequences A0A1X6N3W6 B8NZZ5
XP_002468934.1.31404 jgi|Pospl1|40363|gw1.2.102.1 104341.JGI40363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]