SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X6N6N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X6N6N0
Domain Number 1 Region: 56-119
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000287
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 2 Region: 18-40
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000275
Family CCCH zinc finger 0.0037
Further Details:      
 
Weak hits

Sequence:  A0A1X6N6N0
Domain Number - Region: 148-174
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0523
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1X6N6N0
Sequence length 636
Comment (tr|A0A1X6N6N0|A0A1X6N6N0_9APHY) Uncharacterized protein {ECO:0000313|EMBL:OSX64299.1} OX=670580 OS=Postia placenta MAD-698-R-SB12. GN=POSPLADRAFT_1065543 OC=Agaricomycetes; Polyporales; Dacryobolaceae; Postia.
Sequence
MSLLFLHGESEKLTPYDKSKTCHFYAAGFCRRGDKCWFQHVASDASTSQIQTAPAAEEEE
LCCICYEKPVTYGLLIGCSHMFCIHCIREWRSSNKRSVEVVFSGVTKQCPLCRAASRFVI
PSSQYFPEGHPRKAETINRYKASMARVPCRHFQNSPANRRFCPFGKDCFYQHLKYDGTPY
IFQHGADHNMRIYRRRLERANGRGPHGLIGDLFPDFPDLGATIDALRASLPGLMEGLGLP
MVPMDDADWDIEPEEDFEDRPLVETMEMLAEEVGGRTFYRFGTAPTIPIADNGPAFAPRT
DVQNLGLQPDQQLNTRGLDALVPSTGATPSTVMERAPANRSVSDSPSRFSTVVTREDQAS
TSLSISSLDDLRQLPDLAANPPQVPSLFIPDAVGSLVPQARISSTADTVPPEARQPVIPR
DSATQASATARPSNSQASQEEAPSEPISAPPAEVVHDTDPPFLTDGRGRVVWSSTTAGRH
RGDRESRRAGRAAAATAASASAPAPVQAQQKMRREASDSDVAIARAESGSGEDSGGRERQ
GSRPRQSARVLSSPEGTQQISDGSLEVLDGILSDERRFLLPASDAQAIEGPIASGSTEEP
EALGTDEDEQQLIEEVARRNEGRSFFGRIFGAVLFF
Download sequence
Identical sequences A0A1X6N6N0 B8P0N9
jgi|Pospl1|96448|fgenesh3_pg.5__95 104341.JGI96448 XP_002469220.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]