SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1X7TL27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X7TL27
Domain Number 1 Region: 4-140
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 6.55e-46
Family Nucleoside diphosphate kinase, NDK 0.00014
Further Details:      
 
Weak hits

Sequence:  A0A1X7TL27
Domain Number - Region: 161-190
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00549
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1X7TL27
Sequence length 201
Comment (tr|A0A1X7TL27|A0A1X7TL27_AMPQE) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:Aqu2.1.15474_001} KW=Complete proteome; Reference proteome OX=400682 OS=Amphimedon queenslandica (Sponge). GN= OC=Haplosclerida; Niphatidae; Amphimedon.
Sequence
MADITVEKTLALIKPDAMNWADEIIEEIKRNGFKILQKRRIQLSPEEAANFYAEHYGKMF
FPSLVAFMSSSDIIVMVLAKQNAIKEWKELLGPTDSRRAKEEEPRSLRACYGHDNTKNAL
HGSDSEYAADKEIKFMFPDAYSIMEPVERGTAMKDYLRSQVNPTLVKGLTELCHEKPDDP
LEWLAQWILKNNPNKPQVETI
Download sequence
Identical sequences A0A1X7TL27
Aqu1.210256|PACid:15708784 XP_003390308.1.10788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]