SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1M3H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1M3H2
Domain Number 1 Region: 233-268
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000051
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1M3H2
Sequence length 272
Comment (tr|A0A1Y1M3H2|A0A1Y1M3H2_PHOPY) Uncharacterized protein {ECO:0000313|EMBL:JAV77747.1} OX=7054 OS=Photinus pyralis (Common eastern firefly) (Lampyris pyralis). GN= OC=Elateriformia; Elateroidea; Lampyridae; Lampyrinae; Photinus.
Sequence
HQAGSRITAWVDRNFHTLEEKRQEFIIIDGEVNEKMLYVGIQPRRYYVKHAHTTTQLEDK
KYYKMEDVSKMVCEGSNFILMRYLAITRYVGQFELTTLYINGDICRNLYKCSGVEKGIVN
DQKLDLCKIQRTIIEQCGIVHYSTTILTLHGKSIASFTQNYRLISGQIVKQEWASCNYIL
QVNPLAYIHNEKPIGNEHLLLQHVWEKDMQLMSKFLDCKTEYTMDIKTYLADHPELKSMM
ADYIQQTIFMKPEDILDFTIAHFKRFCQCNDD
Download sequence
Identical sequences A0A1Y1M3H2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]