SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2D9V0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2D9V0
Domain Number 1 Region: 52-153
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000536
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2D9V0
Sequence length 218
Comment (tr|A0A1Y2D9V0|A0A1Y2D9V0_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORY55977.1} KW=Complete proteome; Reference proteome OX=1754190 OS=Neocallimastix californiae. GN=LY90DRAFT_645322 OC=Neocallimastigales; Neocallimastigaceae; Neocallimastix.
Sequence
MNNTKNSNEEIQKELKIILKKNNKTELENYFIEKDIAIKDIRGGGGSDNFDLLIYSIENG
ASLDILKFFITQGQTTLDLNYTTNHHGQEKVPLFSALMNNNFSVADLLLQNKADINYCVN
NKEDGDIIHYLFTHASLNNKNLKYILNHGYDTYFLFTNINSSLITDFIRSFKNKFLEIIF
KHYLFDNAFIINLLKWYKNRTPLSLHHLQGVITKEKIN
Download sequence
Identical sequences A0A1Y2D9V0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]