SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2HEX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Y2HEX3
Domain Number - Region: 17-40
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0131
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2HEX3
Sequence length 72
Comment (tr|A0A1Y2HEX3|A0A1Y2HEX3_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:ORZ33140.1} KW=Complete proteome; Reference proteome OX=765915 OS=Catenaria anguillulae PL171. GN=BCR44DRAFT_81820 OC=Blastocladiales; Catenariaceae; Catenaria.
Sequence
MLPLRRRSHRPLPLKASSTALRHAARFGSVDVLEWWFRVGLIRCDKDLAATATLRSLLER
QFWAYRKLPGKH
Download sequence
Identical sequences A0A1Y2HEX3
jgi|Catan1|81820|estExt_fgenesh1_pm.C_170050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]