SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y2XFK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2XFK1
Domain Number 1 Region: 370-530
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-17
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 11-238
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000000361
Family alpha-mannosidase, C-terminal domain 0.09
Further Details:      
 
Domain Number 3 Region: 260-333
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000392
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2XFK1
Sequence length 532
Comment (tr|A0A1Y2XFK1|A0A1Y2XFK1_9PEZI) Polysaccharide lyase family 4 protein {ECO:0000313|EMBL:OTB20710.1} OX=1001832 OS=Daldinia sp. EC12. GN=K445DRAFT_299821 OC=Sordariomycetes; Xylariomycetidae; Xylariales; Hypoxylaceae; Daldinia.
Sequence
MATRSPSMDVESSGYVTRMWWNGREIVGNATGGYTDTGGKTTFNFTSGPTLIEKTDSMIH
VGFHNADFGDVYYVLFSGLDGHYQYVINQNLGYQGEVRSLYRLDPLQFTWGRTNIKNSPL
PAIQDIKTGYKVQDETWQRPNGSYITKYDFSCYVRDLDFHGIYGDGVGAYVIAPGKDYYI
GDHLKQELMLHRESSTDDAVLLHMYHGTHYNSEFSNLIPPGKTWGPWLFYINNGDLDDAA
ARSKEEDAAWPYTWLQDDKYQQRGTVQGQLILSYGRPAAGAAIFLGDEDGAETNNQGSNY
QYTTYADANGSFILNHVRREKAYRLLAWANGGALADVEGVHNGTAVEFANADSSDIDLGT
ITWEVPVDRHLAWRIGDFDRKTLGFRLGGAQMEHGLSDACPANLIYAIGSSQKNDWCFAL
SAQGNWTVIFPEADDGVRERGAILSLSFAGYTKPTGLNVSMNQQLVGTIVSENATDGALY
RSATTSGGYYARQFIIPGEMFLSDRANRLDLTLTQNHRWRGIMWDALKLEWL
Download sequence
Identical sequences A0A1Y2XFK1
jgi|DalEC12_1|299821|MIX649_617_45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]