SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3B385 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y3B385
Domain Number 1 Region: 25-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000144
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 1-26
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000497
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3B385
Sequence length 128
Comment (tr|A0A1Y3B385|A0A1Y3B385_EURMA) Thrombospondin-like protein {ECO:0000313|EMBL:OTF75271.1} KW=Complete proteome; Reference proteome OX=6958 OS=Euroglyphus maynei (Mayne's house dust mite). GN=BLA29_011257 OC=Analgoidea; Pyroglyphidae; Pyroglyphinae; Euroglyphus.
Sequence
CYCDSACITLGDCCPDYKDTCGVQDCVVSDWEQWSDCNIECGVGTMNRTRRILSQPQNGG
RECPDLNQRRACHGQHCKVRDDEKMLREMAIILQSSFSVTRNIDEDKDIRRNLRLNYPKD
PLKENVNE
Download sequence
Identical sequences A0A1Y3B385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]