SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3BC03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y3BC03
Domain Number 1 Region: 89-212
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.69e-33
Family cAMP-binding domain 0.0000182
Further Details:      
 
Domain Number 2 Region: 213-315
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.18e-26
Family cAMP-binding domain 0.00082
Further Details:      
 
Domain Number 3 Region: 5-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3BC03
Sequence length 386
Comment (tr|A0A1Y3BC03|A0A1Y3BC03_EURMA) cAMP-dependent protein kinase type II regulatory subunit-like protein {ECO:0000313|EMBL:OTF78431.1} KW=Complete proteome; Reference proteome OX=6958 OS=Euroglyphus maynei (Mayne's house dust mite). GN=BLA29_000085 OC=Analgoidea; Pyroglyphidae; Pyroglyphinae; Euroglyphus.
Sequence
MSNHPNYEIPSELNNLLIDFTVSVLVNRPGDLIEYAANYFNRILDERRNSVAVAPKPPAR
LSFTRRKSVFAEHYDPEEDEGDSEQIFYPKSDEQRQRLSEATKNILLFRSLEPTEMNEVI
DAMFERKVEANEVVIKQGDDGDNFYVIADGTFSITVAIDDGTEKEVGKYVGSGSFGELAL
MYNMPRAATVRALTTGSLWAMSRQTFRRIVLKRAFMKRKEYESFIEKVEIFKFLEYYEKM
SLSDAFMAKCYKNGDLIIKQGDEADGMYFVQEGVVRIVKEENGQEQELSRVEKGGYFGEL
ALITKKPRAATVYAAIFLKKKFKLENFLKNKKSLKFFCYTNYTVLDVCAFERLLGPCMDI
MKRNFNHYEDQLVKLFGSKSNVTDLR
Download sequence
Identical sequences A0A1Y3BC03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]