SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3EPI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y3EPI1
Domain Number 1 Region: 441-700
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-41
Family YWTD domain 0.000000985
Further Details:      
 
Domain Number 2 Region: 236-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000458
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 3 Region: 101-146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000798
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 4 Region: 188-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 65-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 145-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 7 Region: 29-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 383-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 305-335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000445
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 10 Region: 356-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000213
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3EPI1
Sequence length 906
Comment (tr|A0A1Y3EPI1|A0A1Y3EPI1_9BILA) Putative Low-density lipoprotein receptor domain class A {ECO:0000313|EMBL:OUC46670.1} OX=6335 OS=Trichinella nativa. GN=D917_07555 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MKSSIFLYICATIFICFHISLATDKDCLNNGGFLCPSGRCISPNWLCDGEQDCEDNADEQ
NCSDRTCRKGEFKCANSNKCIPQSWVCDSSIDCTDRSDEDPAICTKHDCPSDHFRCHLDG
KCIPLTWVCDSHPDCVDGSDELSNMCVKHPCNETEFSCKNERCIPKEWECDRDDDCGDNS
DEHDKCSYHCDPKSFQCVESGKCIPYDYVCDGQMDCSDRSDEMNCKQHMTKLLSEQHGCR
AHEFQCHDGACISERFVCDGDVDCPDMSDEMNCLNNCSALHFRCASGKECIPSVYRCNES
VGQVKHCSARQFDCGNGFCIDWDVVCDGKQDCPGYKVVDEEPFLNCSLKGTDFCKEKPCE
QLCTNTPIGPQCSCRPGYTVSLTNPKQCNDINECNTAGKCSQICINTIGSYVCKCHGDYV
LLNNKRSCRANGPQAKLLLTNRLSIRQFGLISLTPAMLVNNLNSVVAIDYSYKKRLLFWS
DISKEQIFSCQFGNDFHAVNASDCERPIISNNVSSPDGLAVDWIHDLIYWTDTGLDTISV
ATLDGKLRHTLIHDGLDEPRAIAVDPSCGMMFWTDWGVSPKIESAAMDGTNRFAIDRDVI
WPNGLTLDMLEHRLYWVDAKLKQICSSNYFGQDKKVILNSRNRIYHPFSVSVFEETLYWT
DWNSEGVHMANKFTGENNRPLLKGMFGLMTVKIFHPLAQPNWENKCENSECAHLCVPSMK
IAAGQTVPAKMITNIKPYVCLCSDGYSLQANARDCVAKGATTTGDDNGKKTNSYADASTT
TAITTAGDGDDASSSKAGMVLALLFTLSAIVGAVSWFVWKQRPLNVHFGQFFCLSYPFCR
RGQDHYDHLRLTLDNEEYQSGTLISGTGSGIYQPTVKSNIGDVEDGGTALAESPMTTTIQ
RGIPLA
Download sequence
Identical sequences A0A1Y3EPI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]