SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3H7J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y3H7J6
Domain Number 1 Region: 44-127
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0000942
Family Clostridium neurotoxins, "coiled-coil" domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3H7J6
Sequence length 149
Comment (tr|A0A1Y3H7J6|A0A1Y3H7J6_ENTFC) D-alanyl-lipoteichoic acid biosynthesis protein DltD {ECO:0000313|EMBL:OUK10917.1} KW=Complete proteome OX=1352 OS=Enterococcus faecium (Streptococcus faecium). GN=BU185_02860 OC=Enterococcus.
Sequence
RIRAHEPELKQSQKNWDYRFSPEFSDFQLVLDQLAKNHNEVLFIIPPVNEKWSDYTGLSQ
EMLQGFAKKIKFQLNSQGFNRIADFVNQAGTNYFMEDTIHLGWKGWLAADQQIRPFLEEN
HITASKYHLDDAFFSKSWQHQIPDKLQLK
Download sequence
Identical sequences A0A1Y3H7J6
WP_087120544.1.75916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]