SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3HAJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y3HAJ8
Domain Number 1 Region: 45-128
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0000942
Family Clostridium neurotoxins, "coiled-coil" domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3HAJ8
Sequence length 150
Comment (tr|A0A1Y3HAJ8|A0A1Y3HAJ8_ENTFC) D-alanyl-lipoteichoic acid biosynthesis protein DltD {ECO:0000313|EMBL:OUK12491.1} KW=Complete proteome OX=1352 OS=Enterococcus faecium (Streptococcus faecium). GN=BU189_15240 OC=Enterococcus.
Sequence
HRIRAHEPELKKSQKNWDYRFSPEFSDFQLVLDQLAKNHNEVLFIIPPVNEKWSDYTGLS
QEMLQGFAKKIKFQLNSQGFNRIADFVNQAGTNYFMEDTIHLGWKGWLAADQQIRPFLEE
NHITASKYHLDDAFFSKSWQHQIPDKLQLK
Download sequence
Identical sequences A0A1Y3HAJ8
WP_087086191.1.68836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]