SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y3JWG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y3JWG0
Domain Number 1 Region: 36-119
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0000798
Family Clostridium neurotoxins, "coiled-coil" domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y3JWG0
Sequence length 141
Comment (tr|A0A1Y3JWG0|A0A1Y3JWG0_ENTFC) D-alanyl-lipoteichoic acid biosynthesis protein DltD {ECO:0000313|EMBL:OUK43688.1} KW=Complete proteome OX=1352 OS=Enterococcus faecium (Streptococcus faecium). GN=BU183_02935 OC=Enterococcus.
Sequence
LKQSQKNWDYRFSPEFSDFQLVLDQLAKNHNEVLFIIPPVNEKWSDYTGLSQEMLQGFAK
KIKFQLNSQGFNRIADFVNQAGTNYFMEDTIHLGWKGWLAADQQIRPFLEENHITASKYH
LDDAFFSKSWQHQIPDKLQLK
Download sequence
Identical sequences A0A1Y3JWG0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]