SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y5I2R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y5I2R0
Domain Number 1 Region: 28-98
Classification Level Classification E-value
Superfamily Chaperone J-domain 5.89e-23
Family Chaperone J-domain 0.00066
Further Details:      
 
Domain Number 2 Region: 144-218
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000404
Family PDI-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y5I2R0
Sequence length 565
Comment (tr|A0A1Y5I2R0|A0A1Y5I2R0_OSTTA) Uncharacterized protein {ECO:0000313|EMBL:OUS43799.1} KW=Complete proteome OX=70448 OS=Ostreococcus tauri. GN=BE221DRAFT_147106 OC=Mamiellales; Bathycoccaceae; Ostreococcus.
Sequence
MRREKTPKMRGWLLNLIVVEAFLARVVLGARDLYGDLGLDRGVSAIEVKRAYRSLSLIYH
PDKQRTSDDEEKHIANERFMEIQNAYSTLSDPERKRAYDLQMYVEEQSNLNAELNAGHRT
RGTWDSESVAEGLRQRSGFQQAELISSETISLSNKNIEKLVFNSKKAWLIKIYDDTMDAC
HRTWPAWEKASQTLDGITNFGRIHVFMSPRLVQMLGSSGLFARPIRRSDLPVIVGLRPSC
SHYSCVKRYRGPIRVDLLSSFVSEKLLMLSMLPTIEKEDVRIPAIGGKQFVLVSPSMSTA
VIRTRYFAEEYGARVDVKHSHYNQSDKEFWATKFGVNKLPAMLVLEMSTNIVVEDVSSKE
KIRAVFVRNAPRVNTESSATFKVLFKALYVDTTDFMENLWFFLTQTDLLPLIGTICAIIA
ATWFRRVIVRVHKMRYKSTKRAIREDVKSDLVDVHGASLKNKSVYTVVLLTSEPNDRFRE
VAKTYKSEKLLAFVEMSKETANNCSFHEIFLGSTRKSDVIVWHPSREKYQNIGDIDDRVQ
IDRQLHAILDGLAEWIACANVVHSA
Download sequence
Identical sequences A0A1Y5I2R0
70448.Q01CW0 XP_003078103.1.19543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]