SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z4H6H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z4H6H2
Domain Number 1 Region: 349-684
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.05e-45
Family Patatin 0.0000347
Further Details:      
 
Domain Number 2 Region: 9-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-26
Family Pentraxin (pentaxin) 0.1
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Z4H6H2
Sequence length 696
Comment (tr|A0A1Z4H6H2|A0A1Z4H6H2_9CYAN) Patatin {ECO:0000313|EMBL:BAY25360.1} KW=Complete proteome; Reference proteome OX=1954172 OS=Calothrix sp. NIES-2100. GN=NIES2100_51660 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MTNLAETQIVLTFDGVDDYIDFGRNDIGGVFAQGSSAFTISGWINPYELTNKATSYGTRN
VFFARSSERYSDNFEFGISETGSLDVFIDETVSKGIKTFGQGELSIEQWHFFAIVFNSGQ
ITVYLDENEYHDSLRGSSLNKATSSVTLGATLHKQVYFKGQLANISVWNYPCTQAQIQTH
RCGLIAGDEEGLIAYWKLDDGEGTTVKNKTGKSYQGNFRGNPSWELAQIPFATQSFNPVP
FVEELSNQEDIQQEIQIERPVIPEENISTITTNLLAATIPLISKDEDAPKEIQQLQINSE
ESEIVPTLVTLQSEEETKKDQTEEPANIQQAQTLTQGEPPETMNTQAQPKYKILSIDGGG
IRGIIPALILAEIERRTQKPIFSLFDLITGTSSGGILALGLTKPRLSSDVSDLPLAQYTA
EDMVQLFLEYGVEIFYEPLFERLIGPIEDIFLQPKYSSKNREEILSQYFGNANLENNLKE
VFVTSYDIEQRIPVFFTNKLEKQELESKNFHKLCSGFTLLDAALGTTATPTYFAPHRLVN
PYNSGSVYTLIDGGVFANNPAHLAILEAQITSKRKAKKVLNIEDILVVSLGTGSLTSTYP
YKEVKNWGLLQWGRPLLNIVFDSGSEVVSGKLEQLFEPSDEKAKSFYYRFQTFLDAELEE
IDNTKLQNTRQLQAVAHKLISEKSQQIDELCSLLLS
Download sequence
Identical sequences A0A1Z4H6H2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]