SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z4I6C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z4I6C6
Domain Number 1 Region: 349-684
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 6.8e-47
Family Patatin 0.0000398
Further Details:      
 
Domain Number 2 Region: 5-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.28e-27
Family Pentraxin (pentaxin) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Z4I6C6
Sequence length 697
Comment (tr|A0A1Z4I6C6|A0A1Z4I6C6_9NOSO) Patatin {ECO:0000313|EMBL:BAY37594.1} KW=Complete proteome OX=1973475 OS=Nostoc sp. NIES-2111. GN=NIES2111_19330 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MTDLADTQIVLTFDGVDDYIDFGRNDLGGVFAQGSTAFTVSGWINPHELTNKATSYGTRN
VFFARSSERYSDNFEFGISETGSLDVYIDETVSKGIKTFGRGELTIRQWHFFAIVFNNGQ
VTVYLNDNEYTDSFRGSALNKATSSITLGATLHKQVYFKGQLANISVWNYPLTHEQIQTH
RLDLIVGDEEGLVAYWKLNDGQGTTVKNQKGKSYQGNFRGNPSWELAQISFATQLSPQVP
LAEPTSNQEDIQIDTEVISDISEENISILTTDLLAATIPLKSSEEDQTQGITQIDINSEE
SDINLTLITLQSNEDQPKTEQTEVSENIPQPPTFTQEEVPEIMNTEASPKYKILAIDGGG
IRGIIPAFLLAEIERRTQKPIFSLFDLIAGTSSGGILALGLTKPRLNTDVSDNSPVAEYT
AEDLIQLFIEYGVEIFYEPLFERILGPLEDIFLQPKYPSKSKQEILKQYFGDSLLENSLK
EVFVTSYDIEQRLPIFFTNQLEKQEVESKKFRKLCAGFSLLDAALATSATPTYFAPHRIA
SVQNTNGFYTLIDGGVFANNPAHLAILEAQINSKRQANKTLNPEDILVVSLGTGSLTSAY
PYNEVKNWGLLQWGRPLLNIVFDSGSEVVSGELERLFESSDKAAKSYYYRFQALLDGDVE
EIDNIKLKNTRQLQTIAHRLISESSQQIDELCRLLLS
Download sequence
Identical sequences A0A1Z4I6C6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]