SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z4J7A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z4J7A8
Domain Number 1 Region: 354-688
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 8.11e-48
Family Patatin 0.000055
Further Details:      
 
Domain Number 2 Region: 9-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.03e-25
Family Laminin G-like module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Z4J7A8
Sequence length 700
Comment (tr|A0A1Z4J7A8|A0A1Z4J7A8_9CYAN) Patatin {ECO:0000313|EMBL:BAY50158.1} KW=Complete proteome OX=1137095 OS=Scytonema sp. HK-05. GN=SAMD00079811_77870 OC=Bacteria; Cyanobacteria; Nostocales; Scytonemataceae; Scytonema.
Sequence
MTNLVNTRTVLTFDGVDDYIDFGRNDIGGVFAQGSSAFTVSGWVNPYQLTNKATSYGTRN
VFFARSSERYSDNFEFGISETGSIDVYIDESVSKGIKTFGQGELTIGRWHFFAIIFNSGQ
ITVYIDEHEYNDSLRGSSLNKATSSVTLGATLHKQVYFKGQLANISVWNYPCTQAQIQIH
RCGLIVGDEEGLVAYWKLDDGQGTTVKNQTGKSYHGNFRGNPIWTLAEIPFATQSSNPVP
FAAESSNQEEIQEEIQEEIQIETAVISEENILPLTTNLLAASVSLVSNDEDEPKEIQQTE
TNSEESEIIPTPLALQPHDEETKIDQTEEPVNIQEAQILTQEELPESMNTKARPKYKILS
IDGGGIRGIIPAFLLAEIERRTQKPIFSLFDLIAGTSSGGILALGLTKPRLSSSDDLPQA
QYTAEDLIQLFLEYGVEIFYEPFFERLLGPLEDIFLQPKYPSESKEKILRQYFGNAPLEN
NLKEVFVTTYDIEQRIPIFFTNKLEKQEIESKNFSKLCSGFSLLDAALATTATPTYFAPH
RIINSHNSGIVYTLIDGGVFANNPAHLAILEAQISSKRKAQKPLNTEDILVVSLGTGSLT
SAYLYKEVKNWGLLQWGKPLLNIVFDGGSEVVSGQLEQLFESSDGEAKSFYYRFQTFLDE
ELEEIDNTKLQNTRQLQAVAHRLISEKSQQIDELCSLLLG
Download sequence
Identical sequences A0A1Z4J7A8
WP_073629416.1.50723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]