SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z4KE29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z4KE29
Domain Number 1 Region: 6-289
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.28e-35
Family Pectate transeliminase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Z4KE29
Sequence length 694
Comment (tr|A0A1Z4KE29|A0A1Z4KE29_ANAVA) Uncharacterized protein {ECO:0000313|EMBL:BAY67238.1} OX=1973479 OS=Trichormus variabilis NIES-23. GN=NIES23_00100 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MVNNTPITTVYVNPATGNDANTGSRQSPFKTLTRALKATPPKIVQLSAGTYNTANKEVFP
LVIPEGVTVVGNEASKGAGILISGGGEYQSPSFSVQNVTLVLLNRASLRGVTVTNPIAKG
TGVWIESTAPNIANNTFTNCGREGVFTSGTAKPAILDNVFLKNTASGLFMARNSKGEVLR
NVFQKNPLGIAISDFAAPLLVNNKLSENRTAIALSRNARPVLRHNLLVKNTQGGLLINEN
ALPDLGSSQDTAGNIFSNNGEFDIQNTTTQKLVSVGNQLNPTQVKGLVEFPAAIIDIPIQ
SANIRFLDLAGHWATAFVEALVNKGLMSGFPDGTFAPDAPITRAQYAAVIAKTFQLPANN
QPPKFTDIKSDFWAASAITKAAQMGFISGFPDGTFRPMQNLSKVQAIVSIVNGLKLTGGS
PNVLTVYRDRAQIPSYATNPLAVATQNSLVVNYPQTDRLEPLRDITRAEIGALIYQALVA
NGQEKAIASPYIVSPEVDTPSFTDLTGHWAEPFIRGLASMGITSGFADGSYQPNKPMTRA
QYAAMVAVAFNPPARRPATDFADVPKNFWAYKALQIAASGGFVSGFSDRTFRPDQNVQRL
QVIVSLVNGLALSTVDGNNLLIYTDNNNIPEYARKAVVTATQQKITVNYPDPKQLAPTRE
ATRAEVAAMVYQALVAIQRAPSINSPYIISTVGS
Download sequence
Identical sequences A0A1Z4KE29 Q8YWJ6
gi|17229109|ref|NP_485657.1| WP_010995786.1.33676 103690.all1617 NsR108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]