SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z4KFI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z4KFI0
Domain Number 1 Region: 3-324
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.25e-45
Family Pectate transeliminase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Z4KFI0
Sequence length 602
Comment (tr|A0A1Z4KFI0|A0A1Z4KFI0_ANAVA) Uncharacterized protein {ECO:0000313|EMBL:BAY67709.1} OX=1973479 OS=Trichormus variabilis NIES-23. GN=NIES23_04870 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MTQTFYVNPSTGNDANPGSQTAPFKTITQALKVASPDTTIQLANGNYNAASGEVFPLTIP
SSVKVVGNETSKGSNILIEGSGNYLSRTFAGQNVTFVLLNNAELRGVTVTNPASRGSGAW
IESTTPTVANSTFINCKREGVFATGDANPVITGNVFTENAANGMAIAKNSKGQIQGNICF
KTGFGIAVSDTTSPTLIDNKIYENRSGIVVSGTARPILRNNLVENNTDDGLTVIGNALPD
IGNTSNPGGNTLRNNAKFDLQNASSHKLISIGNQLDTTKVTGNVEFIVSQIPTPTPIPTP
TPTPIPTPTPTPIPTPTPTPIPTPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTPIPTPIP
TPIPIPTPIPTPTPIPTPIPTPIPTPTPIPTPIPTPIPTPTPIPTPNPINLKDIGNHWAA
PFIRELVRQGIVSGFPDGTFKPDATMTRAQYAALLVKAFNPSPNRAVIRFKDLAENFWAF
KVIQQAYQGLFLAGFPDNTFRPNDNIQRVQVVVSLVNGLGLGLSANVTNTIKAFDDQAKI
PDYAKDEVAKAIEKGIIVNYPNIKQLNPTRDATRAEVVAIVYQALVDGDRVAAINSPYIV
NA
Download sequence
Identical sequences A0A1Z4KFI0 Q8YV91
gi|17229582|ref|NP_486130.1| NsR99 WP_010996248.1.33676 103690.alr2090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]