SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z4SH53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z4SH53
Domain Number 1 Region: 332-666
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 8.89e-52
Family Patatin 0.0000248
Further Details:      
 
Domain Number 2 Region: 9-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.51e-27
Family Laminin G-like module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Z4SH53
Sequence length 677
Comment (tr|A0A1Z4SH53|A0A1Z4SH53_9NOSO) Patatin {ECO:0000313|EMBL:BAZ54035.1} KW=Complete proteome; Reference proteome OX=2005458 OS=Nostoc sp. NIES-4103. GN=NIES4103_67200 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MTNQVHTQSVLTFDGQDDYIDFGRNDLGGVFAQGSSVFTVSGWVNPHQLTNKATTYGTRN
VFFARSSDRYSDNFEFGISEDGNLDLFIDDTVEKFVRTFGDGELTLGQWHFFAIIFNQGQ
LTIYLDEHKYTGSLRGSSLNKATSPLTLGATLHNRIYFTGQLAHISVWNYPCTQEQIRTH
RCGLIVGNEEGLVAYWKLDEGQGTTVRNQAGSVHNGNLRGNPSWEIAQIPFATPSSNEGE
IQLETAKETTQTNTDSEESDSIQTLLVFQPESEETQTDETSQSEVSINTLLIFPPESEET
KSEVSINVPQQEQPQILTQEKSKETMNTTAQPKYKILSIDGGGIRGIIPAIILAEIEKRT
KKPIFSLFDLITGTSTGGILALGLTKPRLTSDLSENLSVAEYTAEDLLQIYLEYGAEIFY
EPFFEKILGQIEDIFIQPKYSSEGREEILKKYFGDSPLENNLKEVFVTSYDIELRIPVFF
TNKVEKQEIESKRFRKLCSAFTVTDAALATSATPTYFAPHRVSTSHNPNGYYTLVDGGLV
ANNPANLAIVEAQISRQENHQLFNTEDVLVVSLGTGSLTTNYPYKEVKNWGLLQWARPLL
NIVFDGGSEVIAGELERLFEHKGNQNSYYRFQTFLTSELEEIDNTKPENIRKLQAIANRL
ITERSQQIDELCSILCS
Download sequence
Identical sequences A0A1Z4SH53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]