SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z4TUG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z4TUG2
Domain Number 1 Region: 351-686
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.71e-49
Family Patatin 0.0000264
Further Details:      
 
Domain Number 2 Region: 9-202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.59e-26
Family Laminin G-like module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Z4TUG2
Sequence length 699
Comment (tr|A0A1Z4TUG2|A0A1Z4TUG2_9CYAN) Patatin {ECO:0000313|EMBL:BAZ70581.1} KW=Complete proteome OX=2005456 OS=Fischerella sp. NIES-4106. GN=NIES4106_53760 OC=Bacteria; Cyanobacteria; Nostocales; Hapalosiphonaceae; Fischerella.
Sequence
MTSNQYTQSVITFDGQNDYIDFGKNDIGGVFAEGSSAFTISGWVNPLHLTNQATTYRVHN
VFFARSSDRYSDNFEFGISEEGNLDVYIDEKIDNVIKTFGNGELTVGQWHFFAIVFNQGQ
LSVYLDDHEYTGSLTGSTLNRATSPVTLGATLHNNVYFTGQLANISIWNYPCTQVEIQTH
RSGSLVGNEAGLVAYWKLNEGEGISAGDQTGNGHNGKLRGNPSWNFTQIPFAIAQSFNES
EITSSSEEVIESVAEVVFVEVTTNEQAELQQESVQNDAPTQLTTTPKQKKQTRKQSEKST
DIQTPQIIQPEEEETKTDQTSQSEVLVDLQQPQTITQERSPTTMNTTPNTKYKILAIDGG
GIRGIIPALILAEIEKRTQKQIFSLFDLITGTSSGGILALGLTKPRLNPTPSDSAPTAEY
SAEDLVQLFAEYGAEIFYEPFWEKFLGQIEDIFIQPKYSSQSREEILKQYFGDAFLATNL
TEVFVPSYDIEQRIPIFFSNKVEKQQTGSRNFRELCLGFTLLDAALATSATPTYFPPHRI
PTTHNTNGFYTLVDGGLVANNPAHLAILEAQINKRENKQVFNLEEILVVSLGTGSLTSVY
AYNEVKNWGLLQWGIPLLNMVFDGGSEVVAGELERLFASSDQTIKNSYYRFQTFLPSDLE
VIDNTKPENIRQLKALAHELIRKRSQEIDELCSLLTSSI
Download sequence
Identical sequences A0A1Z4TUG2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]