SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z4UTZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z4UTZ9
Domain Number 1 Region: 273-611
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.67e-51
Family Patatin 0.0000259
Further Details:      
 
Domain Number 2 Region: 10-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.99e-28
Family Leech intramolecular trans-sialidase, N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Z4UTZ9
Sequence length 623
Comment (tr|A0A1Z4UTZ9|A0A1Z4UTZ9_9CYAN) Patatin {ECO:0000313|EMBL:BAZ82721.1} OX=1973480 OS=Sphaerospermopsis kisseleviana NIES-73. GN=NIES73_40040 OC=Sphaerospermopsis; Sphaerospermopsis kisseleviana.
Sequence
MENKVIEQWVLTFDGQDDYIDFGRNDPDPVLSEGISGFTVSGWINPHSLTKEATTYGTRN
VFFARSSDRYSDNFEVGVSPTGNLDIYIDEKFSKFIKTLGNGELTIGEWHFFAIVFNQGD
ITVYLDHNQYIEYFTGSTLNKATSPITLGGTLHNDIYFSGQLAHISVWNCACNQEQIKNL
RSGLIVGDEEGLVAYWRLDEGEGTIVNNQTANIYQGNLFGNPSWDLTQITFLGESPAEEE
TKTNQPEATFNIQTAPTLSQEQLAEDINQTDQKKYKILTIDGGGIRGMIPALLLAEIEKR
TQKPIFSLFDLIAGTSTGGILALGLTKPRLNTATADKLTQAEYTAADLSELFIEYGVEIF
YEPLFEKILGPLEDIFLQPKYASTSRVEMLKQYFGDSLIENNLKEVFVTSYDIEQRIPIL
FTNKREKQQIESQRSRNLCAGFSLLDAALATSATPTYFPPHRITTDHNNNGFYTLVDGGV
FANNPAQLAIAEAKMSSKQEANRVVDTKDILMVSLGTGSLTSVYPYNEVKNWGLLQWGRP
LLNIMFDGSSEVVAGELERLFASNNPETTSSYYRFQTFLDTELEEIDKTTLRNIRELKIA
AQQMINQNSQKIDELCSLLLEDV
Download sequence
Identical sequences A0A1Z4UTZ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]