SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z5JB63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z5JB63
Domain Number 1 Region: 41-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.58e-32
Family PAPS reductase-like 0.00077
Further Details:      
 
Domain Number 2 Region: 323-421
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000036
Family PDI-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Z5JB63
Sequence length 422
Comment (tr|A0A1Z5JB63|A0A1Z5JB63_FISSO) Adenylyl-sulfate reductase {ECO:0000313|EMBL:GAX11227.1} KW=Complete proteome; Reference proteome OX=1519565 OS=Fistulifera solaris (Oleaginous diatom). GN=FisN_34Hh054 OC=Bacillariophycidae; Naviculales; Naviculaceae; Fistulifera.
Sequence
MKFASLVLLLPLASAFVAPKAAFRSMTLKAFDQEQYIAESKEMRLKHLEEQAMFALKISC
ENFDNAVFPNAMIAGDVVITDLLGRMGYLKNGKAKIMVVDTFHLFPETMEFLKVLEKKYE
FKAEIFCADGIPVGDKAAFDKRYGADLWKEDIDEYDRVCKVEPFQRGLKTLNTNCMINGR
TRWQGFERAWIDLFENAPIGGGLAKCNPLAYWTFEDTFEYIAKYKVPYHPLHEKGYPSIG
DAKDTIPVPQDGSVKFVNYEWVGDKTVWCEYAKERVGRFVGLQNKDGSTKTECGIHVDGA
ERTWDRDLWESDKSKAKKLSSTDEALEIKKSGKPSVVVVYAPWCQFSQAMEDEYEKFAVA
MAGEMDVYTLRGDEDREFVMENLNTNSFPTVNVIKADGTAVKYESEVRTVEAFSKFVKET
LA
Download sequence
Identical sequences A0A1Z5JB63

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]