SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z5JJ70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z5JJ70
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.08e-36
Family PAPS reductase-like 0.00031
Further Details:      
 
Domain Number 2 Region: 236-349
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000171
Family PDI-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Z5JJ70
Sequence length 352
Comment (tr|A0A1Z5JJ70|A0A1Z5JJ70_FISSO) Phosphoadenosine phosphosulfate reductase {ECO:0000313|EMBL:GAX14053.1} KW=Complete proteome; Reference proteome OX=1519565 OS=Fistulifera solaris (Oleaginous diatom). GN=FisN_5Lh023 OC=Bacillariophycidae; Naviculales; Naviculaceae; Fistulifera.
Sequence
MVLLDVMAQMNVLSLITVVTIDTLHLFPETYQFYDTVQEHYPDLDLRVYTPKVPGSATPT
RQAFDAFYGGDNLYRTDPEKYAYYSKVEPLQRALDELQAHVWFTGRRRDQGDERSQLQFV
EWEDFDKEDVSDRPKRLKVNLLADWTYEQVWSYLQEHDVPYNPLHDRGYKSIGDTMTTRA
VASTAAERSGRFVGLNQTECGMHHHLEKLDRMRLEAIQQNVAFELPTIDCLECDYELTAV
SFFDVIETLSTVLLLEFYSPLCGACQDFAPTMEQVISVVKHGEDSALNHNIQVARYDITV
DQPTPAMEEAGFEVEVTPTLYLVLSKERRPVLYTGQMTSAAILKWIQNQLTE
Download sequence
Identical sequences A0A1Z5JJ70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]