SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z5JTN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z5JTN5
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.59e-34
Family PAPS reductase-like 0.00038
Further Details:      
 
Domain Number 2 Region: 235-350
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000353
Family PDI-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Z5JTN5
Sequence length 356
Comment (tr|A0A1Z5JTN5|A0A1Z5JTN5_FISSO) Phosphoadenosine phosphosulfate reductase {ECO:0000313|EMBL:GAX17380.1} KW=Complete proteome; Reference proteome OX=1519565 OS=Fistulifera solaris (Oleaginous diatom). GN=FisN_5Hh023 OC=Bacillariophycidae; Naviculales; Naviculaceae; Fistulifera.
Sequence
MVLLDVMAQMNVLSLITVVTIDTLHLFPETYQFYDTVQEHYPELDLRVFTPKVPGSATPT
RQAFDAYYGGNDLYRTDPEKYAFHSKVEPLQRALDELQAHVWFTGRRRDQGDERSQLQFV
EWEKFDQEDASDRPKRLKINLMADWTYEQVWSYLHEHDVPYNPLHDRGYKSIGDTMTTRA
VASTAAERSGRFVGLNQTECGMHHHLEKLETMRQEAVHQNVAFELPTIDCLECDYELTAD
TFFDVIEALSNVLLLEFYSPLCGACQDFAPTMEQVVSGAKHGEDWGLNHNIQVARYDITV
DQPTPAMEEAGFEVEVTPTLYLVLSKERRPVLYTGQMTSAAILKWIQNQLTELLHL
Download sequence
Identical sequences A0A1Z5JTN5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]